Anti TIMM44 pAb (ATL-HPA043052 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043052-25

Protein Description: translocase of inner mitochondrial membrane 44 homolog (yeast)
Gene Name: TIMM44
Alternative Gene Name: TIM44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002949: 87%, ENSRNOG00000001058: 87%
Entrez Gene ID: 10469
Uniprot ID: O43615
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKF
• Gene Sequence: EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKF
• Gene ID - Mouse: ENSMUSG00000002949
• Gene ID - Rat: ENSRNOG00000001058
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TIMM44 pAb (ATL-HPA043052 w/enhanced validation) – 4 Found

Lindqvist, Lisa M; Frank, Daniel; McArthur, Kate; Dite, Toby A; Lazarou, Michael; Oakhill, Jonathan S; Kile, Benjamin T; Vaux, David L. Autophagy induced during apoptosis degrades mitochondria and inhibits type I interferon secretion. Cell Death And Differentiation. 2018;25(4):784-796. 

Chin, Hui San; Li, Mark X; Tan, Iris K L; Ninnis, Robert L; Reljic, Boris; Scicluna, Kristen; Dagley, Laura F; Sandow, Jarrod J; Kelly, Gemma L; Samson, Andre L; Chappaz, Stephane; Khaw, Seong L; Chang, Catherine; Morokoff, Andrew; Brinkmann, Kerstin; Webb, Andrew; Hockings, Colin; Hall, Cathrine M; Kueh, Andrew J; Ryan, Michael T; Kluck, Ruth M; Bouillet, Philippe; Herold, Marco J; Gray, Daniel H D; Huang, David C S; van Delft, Mark F; Dewson, Grant. VDAC2 enables BAX to mediate apoptosis and limit tumor development. Nature Communications. 2018;9(1):4976. 

Desmurs, Marjorie; Foti, Michelangelo; Raemy, Etienne; Vaz, Frédéric Maxime; Martinou, Jean-Claude; Bairoch, Amos; Lane, Lydie. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Molecular And Cellular Biology. 2015;35(7):1139-56. 

Carter, Rachel J; Milani, Mateus; Beckett, Alison J; Liu, Shiyu; Prior, Ian A; Cohen, Gerald M; Varadarajan, Shankar. Novel roles of RTN4 and CLIMP-63 in regulating mitochondrial structure, bioenergetics and apoptosis. Cell Death & Disease. 2022;13(5):436.