Anti TIMM29 pAb (ATL-HPA041858)

Atlas Antibodies

Catalog No.: ATL-HPA041858-25

Protein Description: translocase of inner mitochondrial membrane 29
Gene Name: TIMM29
Alternative Gene Name: C19orf52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048429: 85%, ENSRNOG00000009255: 88%
Entrez Gene ID: 90580
Uniprot ID: Q9BSF4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKD
• Gene Sequence: LDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKD
• Gene ID - Mouse: ENSMUSG00000048429
• Gene ID - Rat: ENSRNOG00000009255
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TIMM29 pAb (ATL-HPA041858) – 3 Found

Kang, Yilin; Baker, Michael James; Liem, Michael; Louber, Jade; McKenzie, Matthew; Atukorala, Ishara; Ang, Ching-Seng; Keerthikumar, Shivakumar; Mathivanan, Suresh; Stojanovski, Diana. Tim29 is a novel subunit of the human TIM22 translocase and is involved in complex assembly and stability. Elife. 2016;5( 27554484) 

Kang, Yilin; Anderson, Alexander J; Jackson, Thomas Daniel; Palmer, Catherine S; De Souza, David P; Fujihara, Kenji M; Stait, Tegan; Frazier, Ann E; Clemons, Nicholas J; Tull, Deidreia; Thorburn, David R; McConville, Malcolm J; Ryan, Michael T; Stroud, David A; Stojanovski, Diana. Function of hTim8a in complex IV assembly in neuronal cells provides insight into pathomechanism underlying Mohr-Tranebjærg syndrome. Elife. 2019;8( 31682224) 

Fielden, Laura F; Scott, Nichollas E; Palmer, Catherine S; Khoo, Chen Ai; Newton, Hayley J; Stojanovski, Diana. Proteomic Identification of Coxiella burnetii Effector Proteins Targeted to the Host Cell Mitochondria During Infection. Molecular & Cellular Proteomics : Mcp. 20( 33177156):100005.