Anti TIMM21 pAb (ATL-HPA010587)

Atlas Antibodies

Catalog No.: ATL-HPA010587-25

Protein Description: translocase of inner mitochondrial membrane 21 homolog (yeast)
Gene Name: TIMM21
Alternative Gene Name: C18orf55, HSPC154, TIM21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024645: 63%, ENSRNOG00000015142: 69%
Entrez Gene ID: 29090
Uniprot ID: Q9BVV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRD
• Gene Sequence: LRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRD
• Gene ID - Mouse: ENSMUSG00000024645
• Gene ID - Rat: ENSRNOG00000015142
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.