Anti TIMD4 pAb (ATL-HPA015625 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015625-25

Protein Description: T-cell immunoglobulin and mucin domain containing 4
Gene Name: TIMD4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055546: 28%, ENSRNOG00000015383: 28%
Entrez Gene ID: 91937
Uniprot ID: Q96H15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMP
• Gene Sequence: VFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMP
• Gene ID - Mouse: ENSMUSG00000055546
• Gene ID - Rat: ENSRNOG00000015383
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TIMD4 pAb (ATL-HPA015625 w/enhanced validation) – 1 Found

Chen, Siyuan; Wang, Yuzhen; Liu, Wen; Liang, Yan; Wang, Yingchun; Wu, Zhuanchang; Xu, Liyun; Liang, Xiaohong; Ma, Chunhong; Gao, Lifen. N-Glycosylation at Asn291 Stabilizes TIM-4 and Promotes the Metastasis of NSCLC. Frontiers In Oncology. 12( 35433445):730530.