Anti TIGD7 pAb (ATL-HPA041357)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041357-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TIGD7
Alternative Gene Name: Sancho
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046380: 33%, ENSRNOG00000027238: 34%
Entrez Gene ID: 91151
Uniprot ID: Q6NT04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MNKRGKYTTLNLEEKMKVLSRIEAGRSLKSVMDEFGISKSTFYDIKKNKKLILDFVLKQDMPLVGAEKRKRTTGAKYGDVDDAVYMWYQQKRSAG |
| Gene Sequence | MNKRGKYTTLNLEEKMKVLSRIEAGRSLKSVMDEFGISKSTFYDIKKNKKLILDFVLKQDMPLVGAEKRKRTTGAKYGDVDDAVYMWYQQKRSAG |
| Gene ID - Mouse | ENSMUSG00000046380 |
| Gene ID - Rat | ENSRNOG00000027238 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TIGD7 pAb (ATL-HPA041357) | |
| Datasheet | Anti TIGD7 pAb (ATL-HPA041357) Datasheet (External Link) |
| Vendor Page | Anti TIGD7 pAb (ATL-HPA041357) at Atlas Antibodies |
| Documents & Links for Anti TIGD7 pAb (ATL-HPA041357) | |
| Datasheet | Anti TIGD7 pAb (ATL-HPA041357) Datasheet (External Link) |
| Vendor Page | Anti TIGD7 pAb (ATL-HPA041357) |