Anti TIGD1 pAb (ATL-HPA041717)

Atlas Antibodies

Catalog No.: ATL-HPA041717-25

Protein Description: tigger transposable element derived 1
Gene Name: TIGD1
Alternative Gene Name: EEYORE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044390: 27%, ENSRNOG00000023318: 27%
Entrez Gene ID: 200765
Uniprot ID: Q96MW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNTRMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSM
• Gene Sequence: MIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNTRMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSM
• Gene ID - Mouse: ENSMUSG00000044390
• Gene ID - Rat: ENSRNOG00000023318
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.