Anti THYN1 pAb (ATL-HPA038732)

Atlas Antibodies

Catalog No.: ATL-HPA038732-25

Protein Description: thymocyte nuclear protein 1
Gene Name: THYN1
Alternative Gene Name: THY28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035443: 93%, ENSRNOG00000047053: 93%
Entrez Gene ID: 29087
Uniprot ID: Q9P016
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPL
• Gene Sequence: AFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPL
• Gene ID - Mouse: ENSMUSG00000035443
• Gene ID - Rat: ENSRNOG00000047053
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.