Anti THRSP pAb (ATL-HPA040642)

Atlas Antibodies

Catalog No.: ATL-HPA040642-25

Protein Description: thyroid hormone responsive
Gene Name: THRSP
Alternative Gene Name: Lpgp, LPGP1, S14, SPOT14, THRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035686: 80%, ENSRNOG00000012404: 80%
Entrez Gene ID: 7069
Uniprot ID: Q92748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMT
• Gene Sequence: TYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMT
• Gene ID - Mouse: ENSMUSG00000035686
• Gene ID - Rat: ENSRNOG00000012404
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti THRSP pAb (ATL-HPA040642) – 1 Found

Wang, Qifei; Yang, Junlin; Lin, Xiang; Huang, Zifang; Xie, Chaofan; Fan, Hengwei. Spot14/Spot14R expression may be involved in MSC adipogenic differentiation in patients with adolescent idiopathic scoliosis. Molecular Medicine Reports. 2016;13(6):4636-42.