Anti THEMIS2 pAb (ATL-HPA027513)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027513-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: THEMIS2
Alternative Gene Name: C1orf38, ICB-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037731: 62%, ENSRNOG00000012965: 64%
Entrez Gene ID: 9473
Uniprot ID: Q5TEJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERVLLPFHFPGSF |
| Gene Sequence | GEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERVLLPFHFPGSF |
| Gene ID - Mouse | ENSMUSG00000037731 |
| Gene ID - Rat | ENSRNOG00000012965 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti THEMIS2 pAb (ATL-HPA027513) | |
| Datasheet | Anti THEMIS2 pAb (ATL-HPA027513) Datasheet (External Link) |
| Vendor Page | Anti THEMIS2 pAb (ATL-HPA027513) at Atlas Antibodies |
| Documents & Links for Anti THEMIS2 pAb (ATL-HPA027513) | |
| Datasheet | Anti THEMIS2 pAb (ATL-HPA027513) Datasheet (External Link) |
| Vendor Page | Anti THEMIS2 pAb (ATL-HPA027513) |