Anti THEMIS2 pAb (ATL-HPA027513)

Atlas Antibodies

Catalog No.:
ATL-HPA027513-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: thymocyte selection associated family member 2
Gene Name: THEMIS2
Alternative Gene Name: C1orf38, ICB-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037731: 62%, ENSRNOG00000012965: 64%
Entrez Gene ID: 9473
Uniprot ID: Q5TEJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERVLLPFHFPGSF
Gene Sequence GEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERVLLPFHFPGSF
Gene ID - Mouse ENSMUSG00000037731
Gene ID - Rat ENSRNOG00000012965
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THEMIS2 pAb (ATL-HPA027513)
Datasheet Anti THEMIS2 pAb (ATL-HPA027513) Datasheet (External Link)
Vendor Page Anti THEMIS2 pAb (ATL-HPA027513) at Atlas Antibodies

Documents & Links for Anti THEMIS2 pAb (ATL-HPA027513)
Datasheet Anti THEMIS2 pAb (ATL-HPA027513) Datasheet (External Link)
Vendor Page Anti THEMIS2 pAb (ATL-HPA027513)