Anti THAP9 pAb (ATL-HPA037421)

Atlas Antibodies

Catalog No.: ATL-HPA037421-25

Protein Description: THAP domain containing 9
Gene Name: THAP9
Alternative Gene Name: FLJ34093
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028577: 23%, ENSRNOG00000014443: 26%
Entrez Gene ID: 79725
Uniprot ID: Q9H5L6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSEALLDLSDHRRNLICYAGYVANKLSALLTCEDCITALYASDLKASKIGSLLFVKKKNGLHFPSESLCRVINICERVVRTHSR
• Gene Sequence: LSEALLDLSDHRRNLICYAGYVANKLSALLTCEDCITALYASDLKASKIGSLLFVKKKNGLHFPSESLCRVINICERVVRTHSR
• Gene ID - Mouse: ENSMUSG00000028577
• Gene ID - Rat: ENSRNOG00000014443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.