Anti THAP9 pAb (ATL-HPA037420)

Atlas Antibodies

Catalog No.:
ATL-HPA037420-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: THAP domain containing 9
Gene Name: THAP9
Alternative Gene Name: FLJ34093
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026274: 27%, ENSRNOG00000018681: 25%
Entrez Gene ID: 79725
Uniprot ID: Q9H5L6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTWLSKCQPSPGFNSNIFSFLQRRVENGDQLYQYCSLLIKSIPLKQQLQWDPSSHSLQGFMDFGLGKLDADETPLASETVLLMA
Gene Sequence RTWLSKCQPSPGFNSNIFSFLQRRVENGDQLYQYCSLLIKSIPLKQQLQWDPSSHSLQGFMDFGLGKLDADETPLASETVLLMA
Gene ID - Mouse ENSMUSG00000026274
Gene ID - Rat ENSRNOG00000018681
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THAP9 pAb (ATL-HPA037420)
Datasheet Anti THAP9 pAb (ATL-HPA037420) Datasheet (External Link)
Vendor Page Anti THAP9 pAb (ATL-HPA037420) at Atlas Antibodies

Documents & Links for Anti THAP9 pAb (ATL-HPA037420)
Datasheet Anti THAP9 pAb (ATL-HPA037420) Datasheet (External Link)
Vendor Page Anti THAP9 pAb (ATL-HPA037420)