Anti THAP2 pAb (ATL-HPA039790)

Atlas Antibodies

Catalog No.: ATL-HPA039790-25

Protein Description: THAP domain containing, apoptosis associated protein 2
Gene Name: THAP2
Alternative Gene Name: DKFZP564I0422
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020137: 82%, ENSRNOG00000003993: 81%
Entrez Gene ID: 83591
Uniprot ID: Q9H0W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLED
• Gene Sequence: KSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLED
• Gene ID - Mouse: ENSMUSG00000020137
• Gene ID - Rat: ENSRNOG00000003993
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti THAP2 pAb (ATL-HPA039790) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.