Anti THAP12 pAb (ATL-HPA008758)

Atlas Antibodies

Catalog No.:
ATL-HPA008758-25
Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
ChIP-Exo-Seq composite graph for Anti-THAP12 (HPA008758, Lot 000057032) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)<br/>Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: THAP domain containing 12
Gene Name: THAP12
Alternative Gene Name: DAP4, P52rIPK, PRKRIR, THAP0
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030753: 85%, ENSRNOG00000053923: 88%
Entrez Gene ID: 5612
Uniprot ID: O43422
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen NPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNPSEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFE
Gene Sequence NPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNPSEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFE
Gene ID - Mouse ENSMUSG00000030753
Gene ID - Rat ENSRNOG00000053923
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THAP12 pAb (ATL-HPA008758)
Datasheet Anti THAP12 pAb (ATL-HPA008758) Datasheet (External Link)
Vendor Page Anti THAP12 pAb (ATL-HPA008758) at Atlas Antibodies

Documents & Links for Anti THAP12 pAb (ATL-HPA008758)
Datasheet Anti THAP12 pAb (ATL-HPA008758) Datasheet (External Link)
Vendor Page Anti THAP12 pAb (ATL-HPA008758)
!