Anti TGS1 pAb (ATL-HPA029824)

Atlas Antibodies

Catalog No.:
ATL-HPA029824-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: trimethylguanosine synthase 1
Gene Name: TGS1
Alternative Gene Name: NCOA6IP, PIMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028233: 72%, ENSRNOG00000008156: 68%
Entrez Gene ID: 96764
Uniprot ID: Q96RS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPIMVD
Gene Sequence KHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPIMVD
Gene ID - Mouse ENSMUSG00000028233
Gene ID - Rat ENSRNOG00000008156
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TGS1 pAb (ATL-HPA029824)
Datasheet Anti TGS1 pAb (ATL-HPA029824) Datasheet (External Link)
Vendor Page Anti TGS1 pAb (ATL-HPA029824) at Atlas Antibodies

Documents & Links for Anti TGS1 pAb (ATL-HPA029824)
Datasheet Anti TGS1 pAb (ATL-HPA029824) Datasheet (External Link)
Vendor Page Anti TGS1 pAb (ATL-HPA029824)