Anti TGM4 pAb (ATL-HPA032072 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032072-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TGM4
Alternative Gene Name: TGP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025787: 55%, ENSRNOG00000004320: 58%
Entrez Gene ID: 7047
Uniprot ID: P49221
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SVNFTVILKRKTAALQNVNILGSFELQLYTGKKMAKLCDLNKTSQIQGQVSEVTLTLDSKTYINSLAILDDEPVIRGFIIAEIVESKEIMA |
| Gene Sequence | SVNFTVILKRKTAALQNVNILGSFELQLYTGKKMAKLCDLNKTSQIQGQVSEVTLTLDSKTYINSLAILDDEPVIRGFIIAEIVESKEIMA |
| Gene ID - Mouse | ENSMUSG00000025787 |
| Gene ID - Rat | ENSRNOG00000004320 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TGM4 pAb (ATL-HPA032072 w/enhanced validation) | |
| Datasheet | Anti TGM4 pAb (ATL-HPA032072 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TGM4 pAb (ATL-HPA032072 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TGM4 pAb (ATL-HPA032072 w/enhanced validation) | |
| Datasheet | Anti TGM4 pAb (ATL-HPA032072 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TGM4 pAb (ATL-HPA032072 w/enhanced validation) |