Anti TGM1 pAb (ATL-HPA040171 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040171-25

Protein Description: transglutaminase 1
Gene Name: TGM1
Alternative Gene Name: ICR2, LI, LI1, TGASE, TGK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022218: 74%, ENSRNOG00000020136: 74%
Entrez Gene ID: 7051
Uniprot ID: P22735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA
• Gene Sequence: MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA
• Gene ID - Mouse: ENSMUSG00000022218
• Gene ID - Rat: ENSRNOG00000020136
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TGM1 pAb (ATL-HPA040171 w/enhanced validation) – 3 Found

Landegren, Nils; Ishii, Norito; Aranda-Guillén, Maribel; Gunnarsson, Hörður Ingi; Sardh, Fabian; Hallgren, Åsa; Ståhle, Mona; Hagforsen, Eva; Bradley, Maria; Edqvist, Per-Henrik D; Pontén, Fredrik; Mäkitie, Outi; Eidsmo, Liv; Norlén, Lars; Achour, Adnane; Dahlbom, Ingrid; Korponay-Szabó, Ilma; Agardh, Daniel; Alimohammadi, Mohammad; Eriksson, Daniel; Hashimoto, Takashi; Kämpe, Olle. A gene-centric approach to biomarker discovery identifies transglutaminase 1 as an epidermal autoantigen. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(51) 

Sarmin, Atiya M; El Moussaid, Nadia; Suntornnond, Ratima; Tyler, Eleanor J; Kim, Yang-Hee; Di Cio, Stefania; Megone, William V; Pearce, Oliver; Gautrot, Julien E; Dawson, Jonathan; Connelly, John T. Multi-Scale Analysis of the Composition, Structure, and Function of Decellularized Extracellular Matrix for Human Skin and Wound Healing Models. Biomolecules. 2022;12(6) 

Jones, Christian F E; Di Cio, Stefania; Connelly, John T; Gautrot, Julien E. Design of an Integrated Microvascularized Human Skin-on-a-Chip Tissue Equivalent Model. Frontiers In Bioengineering And Biotechnology. 10( 35928950):915702.