Anti TGFBRAP1 pAb (ATL-HPA037672)

Atlas Antibodies

Catalog No.: ATL-HPA037672-25

Protein Description: transforming growth factor, beta receptor associated protein 1
Gene Name: TGFBRAP1
Alternative Gene Name: TRAP-1, TRAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070939: 88%, ENSRNOG00000024562: 90%
Entrez Gene ID: 9392
Uniprot ID: Q8WUH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SAAWLEKHKKYFALGLLYHYNNQDAAAVQLWVNIVNGDVQDSTRSDLYEYIVDFLTYCLDEELVWAYADWVLQKSEEVGVQVFTKRPLDEQQKNSFNPDD
• Gene Sequence: SAAWLEKHKKYFALGLLYHYNNQDAAAVQLWVNIVNGDVQDSTRSDLYEYIVDFLTYCLDEELVWAYADWVLQKSEEVGVQVFTKRPLDEQQKNSFNPDD
• Gene ID - Mouse: ENSMUSG00000070939
• Gene ID - Rat: ENSRNOG00000024562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.