Anti TGFA pAb (ATL-HPA042297)

Atlas Antibodies

Catalog No.:
ATL-HPA042297-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: transforming growth factor, alpha
Gene Name: TGFA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029999: 93%, ENSRNOG00000016182: 93%
Entrez Gene ID: 7039
Uniprot ID: P01135
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQ
Gene Sequence LENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQ
Gene ID - Mouse ENSMUSG00000029999
Gene ID - Rat ENSRNOG00000016182
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TGFA pAb (ATL-HPA042297)
Datasheet Anti TGFA pAb (ATL-HPA042297) Datasheet (External Link)
Vendor Page Anti TGFA pAb (ATL-HPA042297) at Atlas Antibodies

Documents & Links for Anti TGFA pAb (ATL-HPA042297)
Datasheet Anti TGFA pAb (ATL-HPA042297) Datasheet (External Link)
Vendor Page Anti TGFA pAb (ATL-HPA042297)