Anti TGDS pAb (ATL-HPA039927)

Atlas Antibodies

Catalog No.:
ATL-HPA039927-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TDP-glucose 4,6-dehydratase
Gene Name: TGDS
Alternative Gene Name: SDR2E1, TDPGD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022130: 97%, ENSRNOG00000009661: 96%
Entrez Gene ID: 23483
Uniprot ID: O95455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITRSSNVYGPHQYPEKVIPKFISLLQHNRKCCIHGSGLQTRNFLYATDVVEAFLTVL
Gene Sequence SSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITRSSNVYGPHQYPEKVIPKFISLLQHNRKCCIHGSGLQTRNFLYATDVVEAFLTVL
Gene ID - Mouse ENSMUSG00000022130
Gene ID - Rat ENSRNOG00000009661
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TGDS pAb (ATL-HPA039927)
Datasheet Anti TGDS pAb (ATL-HPA039927) Datasheet (External Link)
Vendor Page Anti TGDS pAb (ATL-HPA039927) at Atlas Antibodies

Documents & Links for Anti TGDS pAb (ATL-HPA039927)
Datasheet Anti TGDS pAb (ATL-HPA039927) Datasheet (External Link)
Vendor Page Anti TGDS pAb (ATL-HPA039927)