Anti TFF2 pAb (ATL-HPA036705 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036705-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: trefoil factor 2
Gene Name: TFF2
Alternative Gene Name: SML1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024028: 87%, ENSRNOG00000001162: 83%
Entrez Gene ID: 7032
Uniprot ID: Q03403
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWC
Gene Sequence PHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWC
Gene ID - Mouse ENSMUSG00000024028
Gene ID - Rat ENSRNOG00000001162
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TFF2 pAb (ATL-HPA036705 w/enhanced validation)
Datasheet Anti TFF2 pAb (ATL-HPA036705 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TFF2 pAb (ATL-HPA036705 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TFF2 pAb (ATL-HPA036705 w/enhanced validation)
Datasheet Anti TFF2 pAb (ATL-HPA036705 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TFF2 pAb (ATL-HPA036705 w/enhanced validation)