Anti TEX101 pAb (ATL-HPA041915 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041915-25

Protein Description: testis expressed 101
Gene Name: TEX101
Alternative Gene Name: CT131, MGC4766, SGRG, SPATA44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062773: 49%, ENSRNOG00000020057: 49%
Entrez Gene ID: 83639
Uniprot ID: Q9BY14
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPG
• Gene Sequence: ELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPG
• Gene ID - Mouse: ENSMUSG00000062773
• Gene ID - Rat: ENSRNOG00000020057
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TEX101 pAb (ATL-HPA041915 w/enhanced validation) – 6 Found

Korbakis, Dimitrios; Brinc, Davor; Schiza, Christina; Soosaipillai, Antoninus; Jarvi, Keith; Drabovich, Andrei P; Diamandis, Eleftherios P. Immunocapture-Selected Reaction Monitoring Screening Facilitates the Development of ELISA for the Measurement of Native TEX101 in Biological Fluids. Molecular & Cellular Proteomics : Mcp. 2015;14(6):1517-26. 

Korbakis, Dimitrios; Schiza, Christina; Brinc, Davor; Soosaipillai, Antoninus; Karakosta, Theano D; Légaré, Christine; Sullivan, Robert; Mullen, Brendan; Jarvi, Keith; Diamandis, Eleftherios P; Drabovich, Andrei P. Preclinical evaluation of a TEX101 protein ELISA test for the differential diagnosis of male infertility. Bmc Medicine. 2017;15(1):60. 

Fagerberg, Linn; Oksvold, Per; Skogs, Marie; Algenäs, Cajsa; Lundberg, Emma; Pontén, Fredrik; Sivertsson, Asa; Odeberg, Jacob; Klevebring, Daniel; Kampf, Caroline; Asplund, Anna; Sjöstedt, Evelina; Al-Khalili Szigyarto, Cristina; Edqvist, Per-Henrik; Olsson, Ingmarie; Rydberg, Urban; Hudson, Paul; Ottosson Takanen, Jenny; Berling, Holger; Björling, Lisa; Tegel, Hanna; Rockberg, Johan; Nilsson, Peter; Navani, Sanjay; Jirström, Karin; Mulder, Jan; Schwenk, Jochen M; Zwahlen, Martin; Hober, Sophia; Forsberg, Mattias; von Feilitzen, Kalle; Uhlén, Mathias. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). Journal Of Proteome Research. 2013;12(6):2439-48. 

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. 

Schiza, Christina; Korbakis, Dimitrios; Panteleli, Efstratia; Jarvi, Keith; Drabovich, Andrei P; Diamandis, Eleftherios P. Discovery of a Human Testis-specific Protein Complex TEX101-DPEP3 and Selection of Its Disrupting Antibodies. Molecular & Cellular Proteomics : Mcp. 2018;17(12):2480-2495. 

Schiza, Christina; Korbakis, Dimitrios; Jarvi, Keith; Diamandis, Eleftherios P; Drabovich, Andrei P. Identification of TEX101-associated Proteins Through Proteomic Measurement of Human Spermatozoa Homozygous for the Missense Variant rs35033974. Molecular & Cellular Proteomics : Mcp. 2019;18(2):338-351.