Anti TCTN1 pAb (ATL-HPA039687)

Atlas Antibodies

Catalog No.: ATL-HPA039687-25

Protein Description: tectonic family member 1
Gene Name: TCTN1
Alternative Gene Name: FLJ21127, JBTS13, TECT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038593: 81%, ENSRNOG00000028523: 80%
Entrez Gene ID: 79600
Uniprot ID: Q2MV58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQ
• Gene Sequence: VPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQ
• Gene ID - Mouse: ENSMUSG00000038593
• Gene ID - Rat: ENSRNOG00000028523
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.