Anti TCF25 pAb (ATL-HPA041786 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041786-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transcription factor 25 (basic helix-loop-helix)
Gene Name: TCF25
Alternative Gene Name: KIAA1049, Nulp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001472: 91%, ENSRNOG00000017023: 90%
Entrez Gene ID: 22980
Uniprot ID: Q9BQ70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QEWEAHRNLSQLPNFAFSVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGVLLPLLESCSVRPDASVSSHRFFGPNAEISQ
Gene Sequence QEWEAHRNLSQLPNFAFSVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGVLLPLLESCSVRPDASVSSHRFFGPNAEISQ
Gene ID - Mouse ENSMUSG00000001472
Gene ID - Rat ENSRNOG00000017023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCF25 pAb (ATL-HPA041786 w/enhanced validation)
Datasheet Anti TCF25 pAb (ATL-HPA041786 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TCF25 pAb (ATL-HPA041786 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TCF25 pAb (ATL-HPA041786 w/enhanced validation)
Datasheet Anti TCF25 pAb (ATL-HPA041786 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TCF25 pAb (ATL-HPA041786 w/enhanced validation)