Anti TCEA2 pAb (ATL-HPA043836)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043836-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TCEA2
Alternative Gene Name: TFIIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059540: 92%, ENSRNOG00000016288: 92%
Entrez Gene ID: 6919
Uniprot ID: Q15560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVG |
| Gene Sequence | MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVG |
| Gene ID - Mouse | ENSMUSG00000059540 |
| Gene ID - Rat | ENSRNOG00000016288 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TCEA2 pAb (ATL-HPA043836) | |
| Datasheet | Anti TCEA2 pAb (ATL-HPA043836) Datasheet (External Link) |
| Vendor Page | Anti TCEA2 pAb (ATL-HPA043836) at Atlas Antibodies |
| Documents & Links for Anti TCEA2 pAb (ATL-HPA043836) | |
| Datasheet | Anti TCEA2 pAb (ATL-HPA043836) Datasheet (External Link) |
| Vendor Page | Anti TCEA2 pAb (ATL-HPA043836) |