Anti TCEA2 pAb (ATL-HPA043836)

Atlas Antibodies

Catalog No.:
ATL-HPA043836-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transcription elongation factor A (SII), 2
Gene Name: TCEA2
Alternative Gene Name: TFIIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059540: 92%, ENSRNOG00000016288: 92%
Entrez Gene ID: 6919
Uniprot ID: Q15560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVG
Gene Sequence MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVG
Gene ID - Mouse ENSMUSG00000059540
Gene ID - Rat ENSRNOG00000016288
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCEA2 pAb (ATL-HPA043836)
Datasheet Anti TCEA2 pAb (ATL-HPA043836) Datasheet (External Link)
Vendor Page Anti TCEA2 pAb (ATL-HPA043836) at Atlas Antibodies

Documents & Links for Anti TCEA2 pAb (ATL-HPA043836)
Datasheet Anti TCEA2 pAb (ATL-HPA043836) Datasheet (External Link)
Vendor Page Anti TCEA2 pAb (ATL-HPA043836)