Anti TCAF2 pAb (ATL-HPA038758)

Atlas Antibodies

Catalog No.:
ATL-HPA038758-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TRPM8 channel associated factor 2
Gene Name: TCAF2
Alternative Gene Name: FAM115C, FAM139A, FLJ40722
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029851: 63%, ENSRNOG00000030222: 63%
Entrez Gene ID: 285966
Uniprot ID: A6NFQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGFPGNIILNCFGLSILPQTLKAGCFPVPTPEMRSYHFRKALSQFQAILNHENGNLEKSCLAKLRVDGAAF
Gene Sequence AGFPGNIILNCFGLSILPQTLKAGCFPVPTPEMRSYHFRKALSQFQAILNHENGNLEKSCLAKLRVDGAAF
Gene ID - Mouse ENSMUSG00000029851
Gene ID - Rat ENSRNOG00000030222
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCAF2 pAb (ATL-HPA038758)
Datasheet Anti TCAF2 pAb (ATL-HPA038758) Datasheet (External Link)
Vendor Page Anti TCAF2 pAb (ATL-HPA038758) at Atlas Antibodies

Documents & Links for Anti TCAF2 pAb (ATL-HPA038758)
Datasheet Anti TCAF2 pAb (ATL-HPA038758) Datasheet (External Link)
Vendor Page Anti TCAF2 pAb (ATL-HPA038758)