Anti TBX2 pAb (ATL-HPA008586)

Atlas Antibodies

Catalog No.: ATL-HPA008586-25

Protein Description: T-box 2
Gene Name: TBX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000093: 96%, ENSRNOG00000008706: 49%
Entrez Gene ID: 6909
Uniprot ID: Q13207
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAAAAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGL
• Gene Sequence: IPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAAAAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGL
• Gene ID - Mouse: ENSMUSG00000000093
• Gene ID - Rat: ENSRNOG00000008706
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TBX2 pAb (ATL-HPA008586) – 2 Found

Schneider, Marc A; Scheffer, Konstanze D; Bund, Timo; Boukhallouk, Fatima; Lambert, Carsten; Cotarelo, Cristina; Pflugfelder, Gert O; Florin, Luise; Spoden, Gilles A. The transcription factors TBX2 and TBX3 interact with human papillomavirus 16 (HPV16) L2 and repress the long control region of HPVs. Journal Of Virology. 2013;87(8):4461-74. 

Saadi, Irfan; Das, Pragnya; Zhao, Minglian; Raj, Lakshmi; Ruspita, Intan; Xia, Yan; Papaioannou, Virginia E; Bei, Marianna. Msx1 and Tbx2 antagonistically regulate Bmp4 expression during the bud-to-cap stage transition in tooth development. Development (Cambridge, England). 2013;140(13):2697-702.