Anti TBCK pAb (ATL-HPA039951)

Atlas Antibodies

Catalog No.: ATL-HPA039951-25

Protein Description: TBC1 domain containing kinase
Gene Name: TBCK
Alternative Gene Name: HSPC302, MGC16169
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028030: 93%, ENSRNOG00000011454: 91%
Entrez Gene ID: 93627
Uniprot ID: Q8TEA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPSSDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRISAEDLIDLCELTVTGHFKTPS
• Gene Sequence: LLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPSSDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRISAEDLIDLCELTVTGHFKTPS
• Gene ID - Mouse: ENSMUSG00000028030
• Gene ID - Rat: ENSRNOG00000011454
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TBCK pAb (ATL-HPA039951) – 2 Found

Gillingham, Alison K; Bertram, Jessie; Begum, Farida; Munro, Sean. In vivo identification of GTPase interactors by mitochondrial relocalization and proximity biotinylation. Elife. 2019;8( 31294692) 

Chong, Jessica X; Caputo, Viviana; Phelps, Ian G; Stella, Lorenzo; Worgan, Lisa; Dempsey, Jennifer C; Nguyen, Alina; Leuzzi, Vincenzo; Webster, Richard; Pizzuti, Antonio; Marvin, Colby T; Ishak, Gisele E; Ardern-Holmes, Simone; Richmond, Zara; Bamshad, Michael J; Ortiz-Gonzalez, Xilma R; Tartaglia, Marco; Chopra, Maya; Doherty, Dan. Recessive Inactivating Mutations in TBCK, Encoding a Rab GTPase-Activating Protein, Cause Severe Infantile Syndromic Encephalopathy. American Journal Of Human Genetics. 2016;98(4):772-81.