Anti TBCD pAb (ATL-HPA045200)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045200-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TBCD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039230: 95%, ENSRNOG00000036658: 95%
Entrez Gene ID: 6904
Uniprot ID: Q9BTW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FQETDKAWHGGCLALAELGRRGLLLPSRLVDVVAVILKALTYDEKRGACSVGTNVRDAACYVCWAFARAYEPQELKPFVTAISSALVIAAVFDRDINCRRAASAAFQENVGRQGTFPHGIDILTTADYFAVGN |
| Gene Sequence | FQETDKAWHGGCLALAELGRRGLLLPSRLVDVVAVILKALTYDEKRGACSVGTNVRDAACYVCWAFARAYEPQELKPFVTAISSALVIAAVFDRDINCRRAASAAFQENVGRQGTFPHGIDILTTADYFAVGN |
| Gene ID - Mouse | ENSMUSG00000039230 |
| Gene ID - Rat | ENSRNOG00000036658 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBCD pAb (ATL-HPA045200) | |
| Datasheet | Anti TBCD pAb (ATL-HPA045200) Datasheet (External Link) |
| Vendor Page | Anti TBCD pAb (ATL-HPA045200) at Atlas Antibodies |
| Documents & Links for Anti TBCD pAb (ATL-HPA045200) | |
| Datasheet | Anti TBCD pAb (ATL-HPA045200) Datasheet (External Link) |
| Vendor Page | Anti TBCD pAb (ATL-HPA045200) |