Anti TBCB pAb (ATL-HPA041428 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041428-25

Protein Description: tubulin folding cofactor B
Gene Name: TBCB
Alternative Gene Name: CG22, CKAP1, CKAPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006095: 82%, ENSRNOG00000045655: 83%
Entrez Gene ID: 1155
Uniprot ID: Q99426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKP
• Gene Sequence: RVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKP
• Gene ID - Mouse: ENSMUSG00000006095
• Gene ID - Rat: ENSRNOG00000045655
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.