Anti TBCA pAb (ATL-HPA036487 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036487-25

Protein Description: tubulin folding cofactor A
Gene Name: TBCA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042043: 91%, ENSRNOG00000048342: 89%
Entrez Gene ID: 6902
Uniprot ID: O75347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEY
• Gene Sequence: MRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEY
• Gene ID - Mouse: ENSMUSG00000042043
• Gene ID - Rat: ENSRNOG00000048342
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.