Anti TBC1D9B pAb (ATL-HPA038350)

Atlas Antibodies

Catalog No.: ATL-HPA038350-25

Protein Description: TBC1 domain family, member 9B (with GRAM domain)
Gene Name: TBC1D9B
Alternative Gene Name: KIAA0676
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036644: 80%, ENSRNOG00000003050: 78%
Entrez Gene ID: 23061
Uniprot ID: Q66K14
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKASVVDPSTESSPAPQEGSEQPASPASPLSSRQSFCAQEAPTASQGLLKLFQKNSPMEDLGAKGAKEKMKEESWHIHFFEYG
• Gene Sequence: RKASVVDPSTESSPAPQEGSEQPASPASPLSSRQSFCAQEAPTASQGLLKLFQKNSPMEDLGAKGAKEKMKEESWHIHFFEYG
• Gene ID - Mouse: ENSMUSG00000036644
• Gene ID - Rat: ENSRNOG00000003050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.