Anti TBC1D8 pAb (ATL-HPA037496)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037496-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TBC1D8
Alternative Gene Name: AD3, HBLP1, VRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003134: 75%, ENSRNOG00000013583: 76%
Entrez Gene ID: 11138
Uniprot ID: O95759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAERDWTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTFEMSHQSQSEL |
| Gene Sequence | SCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAERDWTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTFEMSHQSQSEL |
| Gene ID - Mouse | ENSMUSG00000003134 |
| Gene ID - Rat | ENSRNOG00000013583 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBC1D8 pAb (ATL-HPA037496) | |
| Datasheet | Anti TBC1D8 pAb (ATL-HPA037496) Datasheet (External Link) |
| Vendor Page | Anti TBC1D8 pAb (ATL-HPA037496) at Atlas Antibodies |
| Documents & Links for Anti TBC1D8 pAb (ATL-HPA037496) | |
| Datasheet | Anti TBC1D8 pAb (ATL-HPA037496) Datasheet (External Link) |
| Vendor Page | Anti TBC1D8 pAb (ATL-HPA037496) |