Anti TBC1D8 pAb (ATL-HPA037496)

Atlas Antibodies

Catalog No.:
ATL-HPA037496-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family, member 8 (with GRAM domain)
Gene Name: TBC1D8
Alternative Gene Name: AD3, HBLP1, VRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003134: 75%, ENSRNOG00000013583: 76%
Entrez Gene ID: 11138
Uniprot ID: O95759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAERDWTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTFEMSHQSQSEL
Gene Sequence SCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAERDWTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTFEMSHQSQSEL
Gene ID - Mouse ENSMUSG00000003134
Gene ID - Rat ENSRNOG00000013583
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBC1D8 pAb (ATL-HPA037496)
Datasheet Anti TBC1D8 pAb (ATL-HPA037496) Datasheet (External Link)
Vendor Page Anti TBC1D8 pAb (ATL-HPA037496) at Atlas Antibodies

Documents & Links for Anti TBC1D8 pAb (ATL-HPA037496)
Datasheet Anti TBC1D8 pAb (ATL-HPA037496) Datasheet (External Link)
Vendor Page Anti TBC1D8 pAb (ATL-HPA037496)