Anti TBC1D7 pAb (ATL-HPA034748)

Atlas Antibodies

Catalog No.: ATL-HPA034748-25

Protein Description: TBC1 domain family, member 7
Gene Name: TBC1D7
Alternative Gene Name: dJ257A7.3, FLJ32666
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021368: 81%, ENSRNOG00000014019: 81%
Entrez Gene ID: 51256
Uniprot ID: Q9P0N9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TRRFVNQLNTKYRDSLPQLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLWFKRCFAGCLP
• Gene Sequence: TRRFVNQLNTKYRDSLPQLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLWFKRCFAGCLP
• Gene ID - Mouse: ENSMUSG00000021368
• Gene ID - Rat: ENSRNOG00000014019
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.