Anti TBC1D32 pAb (ATL-HPA013413)

Atlas Antibodies

Catalog No.: ATL-HPA013413-100

Protein Description: TBC1 domain family, member 32
Gene Name: TBC1D32
Alternative Gene Name: bA57L9.1, BROMI, C6orf170, C6orf171, dJ310J6.1, FLJ30899, FLJ34235
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038122: 79%, ENSRNOG00000000802: 64%
Entrez Gene ID: 221322
Uniprot ID: Q96NH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVERNHVLVRINLVGGPLERILPPRLLEKSDNPYPWPMFSSYPLPNCYLSDITRNAGIKQDNDLDKLLLCLKISDKQTEWIENCQRQFCKMMKAKPDIISGEALIELLEKFVLHLTESPSECYFPSVEYTATDANVKNE
• Gene Sequence: SVERNHVLVRINLVGGPLERILPPRLLEKSDNPYPWPMFSSYPLPNCYLSDITRNAGIKQDNDLDKLLLCLKISDKQTEWIENCQRQFCKMMKAKPDIISGEALIELLEKFVLHLTESPSECYFPSVEYTATDANVKNE
• Gene ID - Mouse: ENSMUSG00000038122
• Gene ID - Rat: ENSRNOG00000000802
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.