Anti TBC1D30 pAb (ATL-HPA040043)

Atlas Antibodies

Catalog No.:
ATL-HPA040043-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family, member 30
Gene Name: TBC1D30
Alternative Gene Name: KIAA0984
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052302: 93%, ENSRNOG00000023951: 92%
Entrez Gene ID: 23329
Uniprot ID: Q9Y2I9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLGPFSGFLAPELQKYQKQIKEPNEEQSLRSNNIAELSPGAINSCRSEYHAAFNSMMMERMTTDINALKRQYSRIKKKQQQQVH
Gene Sequence CLGPFSGFLAPELQKYQKQIKEPNEEQSLRSNNIAELSPGAINSCRSEYHAAFNSMMMERMTTDINALKRQYSRIKKKQQQQVH
Gene ID - Mouse ENSMUSG00000052302
Gene ID - Rat ENSRNOG00000023951
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBC1D30 pAb (ATL-HPA040043)
Datasheet Anti TBC1D30 pAb (ATL-HPA040043) Datasheet (External Link)
Vendor Page Anti TBC1D30 pAb (ATL-HPA040043) at Atlas Antibodies

Documents & Links for Anti TBC1D30 pAb (ATL-HPA040043)
Datasheet Anti TBC1D30 pAb (ATL-HPA040043) Datasheet (External Link)
Vendor Page Anti TBC1D30 pAb (ATL-HPA040043)