Anti TBC1D30 pAb (ATL-HPA039772)

Atlas Antibodies

Catalog No.: ATL-HPA039772-100

Protein Description: TBC1 domain family, member 30
Gene Name: TBC1D30
Alternative Gene Name: KIAA0984
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052302: 87%, ENSRNOG00000023951: 89%
Entrez Gene ID: 23329
Uniprot ID: Q9Y2I9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSSPVINHLLLGKKMKMTNRAAKNAVIHIPGHTGGKISPVPYEDLKTKLNSPWRTHIRVHKKNMPRTKSHPGCGDTVGLIDEQNEASKTNGLG
• Gene Sequence: NSSPVINHLLLGKKMKMTNRAAKNAVIHIPGHTGGKISPVPYEDLKTKLNSPWRTHIRVHKKNMPRTKSHPGCGDTVGLIDEQNEASKTNGLG
• Gene ID - Mouse: ENSMUSG00000052302
• Gene ID - Rat: ENSRNOG00000023951
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TBC1D30 pAb (ATL-HPA039772) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.