Anti TBC1D20 pAb (ATL-HPA043613)

Atlas Antibodies

Catalog No.: ATL-HPA043613-25

Protein Description: TBC1 domain family, member 20
Gene Name: TBC1D20
Alternative Gene Name: C20orf140, dJ852M4.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027465: 86%, ENSRNOG00000005766: 89%
Entrez Gene ID: 128637
Uniprot ID: Q96BZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGM
• Gene Sequence: IHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGM
• Gene ID - Mouse: ENSMUSG00000027465
• Gene ID - Rat: ENSRNOG00000005766
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.