Anti TBC1D1 pAb (ATL-HPA041816)

Atlas Antibodies

Catalog No.: ATL-HPA041816-25

Protein Description: TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1
Gene Name: TBC1D1
Alternative Gene Name: KIAA1108, TBC, TBC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029174: 98%, ENSRNOG00000002180: 98%
Entrez Gene ID: 23216
Uniprot ID: Q86TI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENDLLNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKD
• Gene Sequence: ENDLLNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKD
• Gene ID - Mouse: ENSMUSG00000029174
• Gene ID - Rat: ENSRNOG00000002180
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.