Anti TATDN3 pAb (ATL-HPA032092)

Atlas Antibodies

Catalog No.: ATL-HPA032092-25

Protein Description: TatD DNase domain containing 3
Gene Name: TATDN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026632: 88%, ENSRNOG00000010137: 28%
Entrez Gene ID: 128387
Uniprot ID: Q17R31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCL
• Gene Sequence: AGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCL
• Gene ID - Mouse: ENSMUSG00000026632
• Gene ID - Rat: ENSRNOG00000010137
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.