Anti TASP1 pAb (ATL-HPA030825 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA030825-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: taspase, threonine aspartase, 1
Gene Name: TASP1
Alternative Gene Name: C20orf13, dJ585I14.2, FLJ20212
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039033: 90%, ENSRNOG00000004493: 91%
Entrez Gene ID: 55617
Uniprot ID: Q9H6P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEKGMSSGEGLPSRSSQVSAGKITAKELETKQSYKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKAIEKLQAGALATDAVTAALV
Gene Sequence MEKGMSSGEGLPSRSSQVSAGKITAKELETKQSYKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKAIEKLQAGALATDAVTAALV
Gene ID - Mouse ENSMUSG00000039033
Gene ID - Rat ENSRNOG00000004493
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TASP1 pAb (ATL-HPA030825 w/enhanced validation)
Datasheet Anti TASP1 pAb (ATL-HPA030825 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TASP1 pAb (ATL-HPA030825 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TASP1 pAb (ATL-HPA030825 w/enhanced validation)
Datasheet Anti TASP1 pAb (ATL-HPA030825 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TASP1 pAb (ATL-HPA030825 w/enhanced validation)