Anti TARS pAb (ATL-HPA037425)

Atlas Antibodies

Catalog No.:
ATL-HPA037425-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: threonyl-tRNA synthetase
Gene Name: TARS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022241: 78%, ENSRNOG00000019023: 78%
Entrez Gene ID: 6897
Uniprot ID: P26639
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEMYNIL
Gene Sequence MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEMYNIL
Gene ID - Mouse ENSMUSG00000022241
Gene ID - Rat ENSRNOG00000019023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TARS pAb (ATL-HPA037425)
Datasheet Anti TARS pAb (ATL-HPA037425) Datasheet (External Link)
Vendor Page Anti TARS pAb (ATL-HPA037425) at Atlas Antibodies

Documents & Links for Anti TARS pAb (ATL-HPA037425)
Datasheet Anti TARS pAb (ATL-HPA037425) Datasheet (External Link)
Vendor Page Anti TARS pAb (ATL-HPA037425)