Anti TAPT1 pAb (ATL-HPA042567)

Atlas Antibodies

Catalog No.: ATL-HPA042567-25

Protein Description: transmembrane anterior posterior transformation 1
Gene Name: TAPT1
Alternative Gene Name: FLJ90013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046985: 88%, ENSRNOG00000003174: 87%
Entrez Gene ID: 202018
Uniprot ID: Q6NXT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEKLSNPPATCTPGKPSSKSQNKCKPSQGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQDNSELKHRSSKKD
• Gene Sequence: EEKLSNPPATCTPGKPSSKSQNKCKPSQGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQDNSELKHRSSKKD
• Gene ID - Mouse: ENSMUSG00000046985
• Gene ID - Rat: ENSRNOG00000003174
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TAPT1 pAb (ATL-HPA042567) – 3 Found

Symoens, Sofie; Barnes, Aileen M; Gistelinck, Charlotte; Malfait, Fransiska; Guillemyn, Brecht; Steyaert, Wouter; Syx, Delfien; D'hondt, Sanne; Biervliet, Martine; De Backer, Julie; Witten, Eckhard P; Leikin, Sergey; Makareeva, Elena; Gillessen-Kaesbach, Gabriele; Huysseune, Ann; Vleminckx, Kris; Willaert, Andy; De Paepe, Anne; Marini, Joan C; Coucke, Paul J. Genetic Defects in TAPT1 Disrupt Ciliogenesis and Cause a Complex Lethal Osteochondrodysplasia. American Journal Of Human Genetics. 2015;97(4):521-34. 

Ascari, Giulia; Peelman, Frank; Farinelli, Pietro; Rosseel, Toon; Lambrechts, Nina; Wunderlich, Kirsten A; Wagner, Matias; Nikopoulos, Konstantinos; Martens, Pernille; Balikova, Irina; Derycke, Lara; Holtappels, Gabriële; Krysko, Olga; Van Laethem, Thalia; De Jaegere, Sarah; Guillemyn, Brecht; De Rycke, Riet; De Bleecker, Jan; Creytens, David; Van Dorpe, Jo; Gerris, Jan; Bachert, Claus; Neuhofer, Christiane; Walraedt, Sophie; Bischoff, Almut; Pedersen, Lotte B; Klopstock, Thomas; Rivolta, Carlo; Leroy, Bart P; De Baere, Elfride; Coppieters, Frauke. Functional characterization of the first missense variant in CEP78, a founder allele associated with cone-rod dystrophy, hearing loss, and reduced male fertility. Human Mutation. 2020;41(5):998-1011. 

Nabavizadeh, Nasrinsadat; Bressin, Annkatrin; Shboul, Mohammad; Moreno Traspas, Ricardo; Chia, Poh Hui; Bonnard, Carine; Szenker-Ravi, Emmanuelle; Sarıbaş, Burak; Beillard, Emmanuel; Altunoglu, Umut; Hojati, Zohreh; Drutman, Scott; Freier, Susanne; El-Khateeb, Mohammad; Fathallah, Rajaa; Casanova, Jean-Laurent; Soror, Wesam; Arafat, Alaa; Escande-Beillard, Nathalie; Mayer, Andreas; Reversade, Bruno. A progeroid syndrome caused by a deep intronic variant in TAPT1 is revealed by RNA/SI-NET sequencing. Embo Molecular Medicine. 2023;15(2):e16478.