Anti TANGO6 pAb (ATL-HPA041312)

Atlas Antibodies

Catalog No.:
ATL-HPA041312-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transport and golgi organization 6 homolog (Drosophila)
Gene Name: TANGO6
Alternative Gene Name: FLJ12688, KIAA1746, TMCO7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041949: 73%, ENSRNOG00000022524: 78%
Entrez Gene ID: 79613
Uniprot ID: Q9C0B7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKELTHVASENETELKTEPFSSKSLLELEQHQTLLVEGQERKLLVLQLMAVLCERMSEQIFTNVTQVVDFVAATLQRACASLAHQAESTVESQTLS
Gene Sequence LKELTHVASENETELKTEPFSSKSLLELEQHQTLLVEGQERKLLVLQLMAVLCERMSEQIFTNVTQVVDFVAATLQRACASLAHQAESTVESQTLS
Gene ID - Mouse ENSMUSG00000041949
Gene ID - Rat ENSRNOG00000022524
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TANGO6 pAb (ATL-HPA041312)
Datasheet Anti TANGO6 pAb (ATL-HPA041312) Datasheet (External Link)
Vendor Page Anti TANGO6 pAb (ATL-HPA041312) at Atlas Antibodies

Documents & Links for Anti TANGO6 pAb (ATL-HPA041312)
Datasheet Anti TANGO6 pAb (ATL-HPA041312) Datasheet (External Link)
Vendor Page Anti TANGO6 pAb (ATL-HPA041312)