Anti TAMM41 pAb (ATL-HPA036834)

Atlas Antibodies

Catalog No.: ATL-HPA036834-25

Protein Description: TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae)
Gene Name: TAMM41
Alternative Gene Name: C3orf31, DKFZp434E0519, MGC16471
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030316: 78%, ENSRNOG00000007874: 76%
Entrez Gene ID: 132001
Uniprot ID: Q96BW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFL
• Gene Sequence: MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFL
• Gene ID - Mouse: ENSMUSG00000030316
• Gene ID - Rat: ENSRNOG00000007874
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TAMM41 pAb (ATL-HPA036834) – 1 Found

Blunsom, Nicholas J; Gomez-Espinosa, Evelyn; Ashlin, Tim G; Cockcroft, Shamshad. Mitochondrial CDP-diacylglycerol synthase activity is due to the peripheral protein, TAMM41 and not due to the integral membrane protein, CDP-diacylglycerol synthase 1. Biochimica Et Biophysica Acta. Molecular And Cell Biology Of Lipids. 2018;1863(3):284-298.