Anti TAGLN pAb (ATL-HPA019467 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019467-25

Protein Description: transgelin
Gene Name: TAGLN
Alternative Gene Name: DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032085: 97%, ENSRNOG00000017628: 96%
Entrez Gene ID: 6876
Uniprot ID: Q01995
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV
• Gene Sequence: EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV
• Gene ID - Mouse: ENSMUSG00000032085
• Gene ID - Rat: ENSRNOG00000017628
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TAGLN pAb (ATL-HPA019467 w/enhanced validation) – 3 Found

Kryza, Thomas; Silva, Lakmali M; Bock, Nathalie; Fuhrman-Luck, Ruth A; Stephens, Carson R; Gao, Jin; Samaratunga, Hema; Lawrence, Mitchell G; Hooper, John D; Dong, Ying; Risbridger, Gail P; Clements, Judith A. Kallikrein-related peptidase 4 induces cancer-associated fibroblast features in prostate-derived stromal cells. Molecular Oncology. 2017;11(10):1307-1329. 

Zelenova, Elena A; Kondratyev, Nikolay V; Lezheiko, Tatyana V; Tsarapkin, Grigoriy Y; Kryukov, Andrey I; Kishinevsky, Alexander E; Tovmasyan, Anna S; Momotyuk, Ekaterina D; Dashinimaev, Erdem B; Golimbet, Vera E. Characterisation of Neurospheres-Derived Cells from Human Olfactory Epithelium. Cells. 2021;10(7) 

Chen, Zhicong; He, Shiming; Zhan, Yonghao; He, Anbang; Fang, Dong; Gong, Yanqing; Li, Xuesong; Zhou, Liqun. TGF-β-induced transgelin promotes bladder cancer metastasis by regulating epithelial-mesenchymal transition and invadopodia formation. Ebiomedicine. 2019;47( 31420300):208-220.