Anti TAF8 pAb (ATL-HPA031734)

Atlas Antibodies

Catalog No.:
ATL-HPA031734-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
Gene Name: TAF8
Alternative Gene Name: FLJ32821, TAF(II)43, TBN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023980: 100%, ENSRNOG00000015249: 98%
Entrez Gene ID: 129685
Uniprot ID: Q7Z7C8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSY
Gene Sequence GSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSY
Gene ID - Mouse ENSMUSG00000023980
Gene ID - Rat ENSRNOG00000015249
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TAF8 pAb (ATL-HPA031734)
Datasheet Anti TAF8 pAb (ATL-HPA031734) Datasheet (External Link)
Vendor Page Anti TAF8 pAb (ATL-HPA031734) at Atlas Antibodies

Documents & Links for Anti TAF8 pAb (ATL-HPA031734)
Datasheet Anti TAF8 pAb (ATL-HPA031734) Datasheet (External Link)
Vendor Page Anti TAF8 pAb (ATL-HPA031734)