Anti TAF13 pAb (ATL-HPA044492)

Atlas Antibodies

Catalog No.:
ATL-HPA044492-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa
Gene Name: TAF13
Alternative Gene Name: TAF2K, TAFII18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048100: 100%, ENSRNOG00000020315: 100%
Entrez Gene ID: 6884
Uniprot ID: Q15543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRA
Gene Sequence EDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRA
Gene ID - Mouse ENSMUSG00000048100
Gene ID - Rat ENSRNOG00000020315
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TAF13 pAb (ATL-HPA044492)
Datasheet Anti TAF13 pAb (ATL-HPA044492) Datasheet (External Link)
Vendor Page Anti TAF13 pAb (ATL-HPA044492) at Atlas Antibodies

Documents & Links for Anti TAF13 pAb (ATL-HPA044492)
Datasheet Anti TAF13 pAb (ATL-HPA044492) Datasheet (External Link)
Vendor Page Anti TAF13 pAb (ATL-HPA044492)