Anti TAF12 pAb (ATL-HPA008519)

Atlas Antibodies

Catalog No.:
ATL-HPA008519-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
Gene Name: TAF12
Alternative Gene Name: TAF2J, TAFII20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028899: 96%, ENSRNOG00000048288: 97%
Entrez Gene ID: 6883
Uniprot ID: Q16514
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIR
Gene Sequence NLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIR
Gene ID - Mouse ENSMUSG00000028899
Gene ID - Rat ENSRNOG00000048288
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TAF12 pAb (ATL-HPA008519)
Datasheet Anti TAF12 pAb (ATL-HPA008519) Datasheet (External Link)
Vendor Page Anti TAF12 pAb (ATL-HPA008519) at Atlas Antibodies

Documents & Links for Anti TAF12 pAb (ATL-HPA008519)
Datasheet Anti TAF12 pAb (ATL-HPA008519) Datasheet (External Link)
Vendor Page Anti TAF12 pAb (ATL-HPA008519)