Anti SYNPO2 pAb (ATL-HPA030665 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030665-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SYNPO2
Alternative Gene Name: MYOPODIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050315: 68%, ENSRNOG00000014867: 69%
Entrez Gene ID: 171024
Uniprot ID: Q9UMS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDKVGGTPSREQDAAQTDGLRTTTSYQRKEEESVRTQSSVSKSYIEVSHGLGHVPQQNGFSGASETANIQRMVPMNRTAKPFPGSVNQPAT |
| Gene Sequence | EDKVGGTPSREQDAAQTDGLRTTTSYQRKEEESVRTQSSVSKSYIEVSHGLGHVPQQNGFSGASETANIQRMVPMNRTAKPFPGSVNQPAT |
| Gene ID - Mouse | ENSMUSG00000050315 |
| Gene ID - Rat | ENSRNOG00000014867 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SYNPO2 pAb (ATL-HPA030665 w/enhanced validation) | |
| Datasheet | Anti SYNPO2 pAb (ATL-HPA030665 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SYNPO2 pAb (ATL-HPA030665 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SYNPO2 pAb (ATL-HPA030665 w/enhanced validation) | |
| Datasheet | Anti SYNPO2 pAb (ATL-HPA030665 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SYNPO2 pAb (ATL-HPA030665 w/enhanced validation) |
| Citations for Anti SYNPO2 pAb (ATL-HPA030665 w/enhanced validation) – 2 Found |
| Gan, Liping; Camarena, Vladimir; Mustafi, Sushmita; Wang, Gaofeng. Vitamin C Inhibits Triple-Negative Breast Cancer Metastasis by Affecting the Expression of YAP1 and Synaptopodin 2. Nutrients. 2019;11(12) PubMed |
| Mao, Youying; Schneider, Ronen; van der Ven, Peter F M; Assent, Marvin; Lohanadan, Keerthika; Klämbt, Verena; Buerger, Florian; Kitzler, Thomas M; Deutsch, Konstantin; Nakayama, Makiko; Majmundar, Amar J; Mann, Nina; Hermle, Tobias; Onuchic-Whitford, Ana C; Zhou, Wei; Margam, Nandini Nagarajan; Duncan, Roy; Marquez, Jonathan; Khokha, Mustafa; Fathy, Hanan M; Kari, Jameela A; El Desoky, Sherif; Eid, Loai A; Awad, Hazem Subhi; Al-Saffar, Muna; Mane, Shrikant; Lifton, Richard P; Fürst, Dieter O; Shril, Shirlee; Hildebrandt, Friedhelm. Recessive Mutations in SYNPO2 as a Candidate of Monogenic Nephrotic Syndrome. Kidney International Reports. 2021;6(2):472-483. PubMed |