Anti SYNJ2BP pAb (ATL-HPA000866)

Atlas Antibodies

Catalog No.: ATL-HPA000866-25

Protein Description: synaptojanin 2 binding protein
Gene Name: SYNJ2BP
Alternative Gene Name: Arip2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090935: 96%, ENSRNOG00000006399: 95%
Entrez Gene ID: 55333
Uniprot ID: P57105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEG
• Gene Sequence: NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEG
• Gene ID - Mouse: ENSMUSG00000090935
• Gene ID - Rat: ENSRNOG00000006399
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SYNJ2BP pAb (ATL-HPA000866) – 8 Found

Hung, Victoria; Lam, Stephanie S; Udeshi, Namrata D; Svinkina, Tanya; Guzman, Gaelen; Mootha, Vamsi K; Carr, Steven A; Ting, Alice Y. Proteomic mapping of cytosol-facing outer mitochondrial and ER membranes in living human cells by proximity biotinylation. Elife. 2017;6( 28441135) 

Coukos, Robert; Yao, David; Sanchez, Mateo I; Strand, Eric T; Olive, Meagan E; Udeshi, Namrata D; Weissman, Jonathan S; Carr, Steven A; Bassik, Michael C; Ting, Alice Y. An engineered transcriptional reporter of protein localization identifies regulators of mitochondrial and ER membrane protein trafficking in high-throughput CRISPRi screens. Elife. 2021;10( 34414886) 

Rusilowicz-Jones, Emma V; Barone, Francesco G; Lopes, Fernanda Martins; Stephen, Elezabeth; Mortiboys, Heather; Urbé, Sylvie; Clague, Michael J. Benchmarking a highly selective USP30 inhibitor for enhancement of mitophagy and pexophagy. Life Science Alliance. 2022;5(2) 

Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. 

Hartmann, Christian; Schwietzer, Ysabel Alessa; Kummer, Daniel; Kirschnick, Nils; Hoppe, Esther; Thüring, Eva-Maria; Glaesner-Ebnet, Mark; Brinkmann, Frauke; Gerke, Volker; Reuter, Stefan; Nakayama, Masanori; Ebnet, Klaus. The mitochondrial outer membrane protein SYNJ2BP interacts with the cell adhesion molecule TMIGD1 and can recruit it to mitochondria. Bmc Molecular And Cell Biology. 2020;21(1):30. 

Rusilowicz-Jones, Emma V; Jardine, Jane; Kallinos, Andreas; Pinto-Fernandez, Adan; Guenther, Franziska; Giurrandino, Mariacarmela; Barone, Francesco G; McCarron, Katy; Burke, Christopher J; Murad, Alejandro; Martinez, Aitor; Marcassa, Elena; Gersch, Malte; Buckmelter, Alexandre J; Kayser-Bricker, Katherine J; Lamoliatte, Frederic; Gajbhiye, Akshada; Davis, Simon; Scott, Hannah C; Murphy, Emma; England, Katherine; Mortiboys, Heather; Komander, David; Trost, Matthias; Kessler, Benedikt M; Ioannidis, Stephanos; Ahlijanian, Michael K; Urbé, Sylvie; Clague, Michael J. USP30 sets a trigger threshold for PINK1-PARKIN amplification of mitochondrial ubiquitylation. Life Science Alliance. 2020;3(8) 

Ilacqua, Nicolò; Anastasia, Irene; Aloshyn, Danylo; Ghandehari-Alavijeh, Rana; Peluso, Emily Ann; Brearley-Sholto, Madelaine C; Pellegrini, Leonardo V; Raimondi, Andrea; de Aguiar Vallim, Thomas Q; Pellegrini, Luca. Expression of Synj2bp in mouse liver regulates the extent of wrappER-mitochondria contact to maintain hepatic lipid homeostasis. Biology Direct. 2022;17(1):37. 

Qin, Wei; Myers, Samuel A; Carey, Dominique K; Carr, Steven A; Ting, Alice Y. Spatiotemporally-resolved mapping of RNA binding proteins via functional proximity labeling reveals a mitochondrial mRNA anchor promoting stress recovery. Nature Communications. 2021;12(1):4980.